product name: the general name of product.organism name: The scientific name is indicated as the organism name, in principle. ![]() Complete sequence of maize catalase coding gene DEFINITION Zea mays Cat3 gene for catalase, complete cds.įormat: gene for, complete cds. “DEFINITION” is constructed by each of the three data banks in accordance with standard rules in principle.However, in the case of EST or GSS submission using Mass Submission System, DDBJ will sometimes ask submitters to construct “DEFINITION”. The definition briefly describes the information of gene(s). The corresponding entries of the CON entry have been submitted to other divisions. The entry in the CON division has the information of joined accession numbers instead of the sequence data. Such entries are classified into the CON division. To conjugate a series of entries, such as those submitted from a genome project, each of the three data banks constructs an entry and assign an accession number to a large scale sequence dataset. ![]() The information of chromosome, map, PCR_condition is necessary for this division. The sequence submitted mainly from genome sequencing projects which regarded a clone as a sequencing unit. When the sequence becomes finished later, it moves to the corresponding taxonomic division. This division is to include unfinished high throughput cDNA sequences, each of which has 5’UTR and 3’UTR at both ends and part of a coding region. The sequence submitted from cDNA sequencing projects except for EST. Genome survey sequences short single pass genomic sequences Transcriptome shotgun assemblies assembled mRNA sequences Synthetic constructs artificially constructed sequencesĮxpressed sequence tags short single pass cDNA sequences Sequences obtained via environmental sampling methods The data those which Japan Patent Office (JPO), United States Patent and Trademark Office (USPTO), European Patent Office (EPO), and Korean Intellectual Property Office (KIPO) collected, processed and released. Sequence data related to patent application Plants, fungi, plastids (eukaryotes other than animals)īacteria (including both Eubacteria and Archaea) Invertebrates (animals other than vertebrates) Mammals (other than primates and rodents) FIELD COMMENTSĭDBJ classifies entries into 21 divisions as below Please take that point into consideration when you refer search results. Vary according to the submitter’s research aim etc. YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTGġ cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctctĦ1 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcggġ21 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgcġ81 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgtĢ41 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcggģ01 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagacģ61 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgcįlat file displays the information provided by submitters with DDBJĮven when the sequences are similar, the contents on the flat files may translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT product="glyceraldehyde-3-phosphate dehydrogenase" clone_lib="lambda gt11 human liver cDNA (GeneTech. TITLE Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver National Institute of Genetics, DNA Data Bank of Japan Yata 1111,ĪUTHORS Mishima,H., Shizuoka,T. JOURNAL Submitted (3) to the DDBJ/EMBL/GenBank databases. Mammalia Eutheria Euarchontoglires Primates Haplorrhini The virtual sample of DDBJ flat file LOCUS AB000000 450 bp mRNA linear HUM 0 DEFINITION Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphateĮukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi To describe the biological nature such as gene function and other The DDBJ/ENA/GenBank Feature Table Definition Organisms, and “feature” information, etc. ![]() Sequence and the information of submitters, references, source The entry submitted to DDBJ is processed and publicized according to theĭDBJ format for distribution (flat file). ![]() The database is a collection of “entry” which is the unit of the data. Office (EPO), United States Patent and Trademark The database also includes the data from Japan Patent With the rule agreed with the three databanks. DDBJ flat file format DDBJ flat file formatĭDBJ/EMBL-Bank/GenBank, the International Nucleotide Sequence DatabaseĬollaboration ( INSDC) collects the nucleotide sequencesĮxperimentally determined, and constructs the database in accordance
0 Comments
Leave a Reply. |